RIMBP2,KIAA0318
  • RIMBP2,KIAA0318

Anti-RIMBP2 Antibody 25ul

Ref: AN-HPA044114-25ul
Anti-RIMBP2

Información del producto

Polyclonal Antibody against Human RIMBP2, Gene description: RIMS binding protein 2, Alternative Gene Names: KIAA0318, MGC15831, PPP1R133, RBP2, RIM-BP2, Validated applications: IHC, Uniprot ID: O15034, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RIMBP2
Gene Description RIMS binding protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RVDNITQISAQLSWLPTNSNYSHVIFLNEEEFDIVKAARYKYQFFNLRPNMAYKVKVLAKPHQMPWQLPLEQREKKEAFVEFSTLP
Immunogen RVDNITQISAQLSWLPTNSNYSHVIFLNEEEFDIVKAARYKYQFFNLRPNMAYKVKVLAKPHQMPWQLPLEQREKKEAFVEFSTLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0318, MGC15831, PPP1R133, RBP2, RIM-BP2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15034
HTS Code 3002150000
Gene ID 23504
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RIMBP2 Antibody 25ul

Anti-RIMBP2 Antibody 25ul