HGF,DFNB39,F-TCF
  • HGF,DFNB39,F-TCF

Anti-HGF Antibody 100ul

Ref: AN-HPA044088-100ul
Anti-HGF

Información del producto

Polyclonal Antibody against Human HGF, Gene description: hepatocyte growth factor (hepapoietin A; scatter factor), Alternative Gene Names: DFNB39, F-TCF, HGFB, HPTA, SF, Validated applications: IHC, Uniprot ID: P14210, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HGF
Gene Description hepatocyte growth factor (hepapoietin A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEA
Immunogen GPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DFNB39, F-TCF, HGFB, HPTA, SF
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P14210
HTS Code 3002150000
Gene ID 3082
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HGF Antibody 100ul

Anti-HGF Antibody 100ul