VAT1L,KIAA1576
  • VAT1L,KIAA1576

Anti-VAT1L Antibody 100ul

Ref: AN-HPA044061-100ul
Anti-VAT1L

Información del producto

Polyclonal Antibody against Human VAT1L, Gene description: vesicle amine transport 1-like, Alternative Gene Names: KIAA1576, Validated applications: ICC, WB, Uniprot ID: Q9HCJ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name VAT1L
Gene Description vesicle amine transport 1-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence DNPPKTPLVPGFECSGIVEALGDSVKGYEIGDRVMAFVNYNAWAEVVCTPVEFVYKIPDDMSFSEAAAFPMNFVTAYVMLFEVANL
Immunogen DNPPKTPLVPGFECSGIVEALGDSVKGYEIGDRVMAFVNYNAWAEVVCTPVEFVYKIPDDMSFSEAAAFPMNFVTAYVMLFEVANL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1576
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HCJ6
HTS Code 3002150000
Gene ID 57687
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-VAT1L Antibody 100ul

Anti-VAT1L Antibody 100ul