CABS1,C4orf35,CLPH
  • CABS1,C4orf35,CLPH

Anti-CABS1 Antibody 100ul

Ref: AN-HPA044016-100ul
Anti-CABS1

Información del producto

Polyclonal Antibody against Human CABS1, Gene description: calcium-binding protein, spermatid-specific 1, Alternative Gene Names: C4orf35, CLPH, FLJ32897, NYD-SP26, Validated applications: IHC, Uniprot ID: Q96KC9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CABS1
Gene Description calcium-binding protein, spermatid-specific 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GTTNSITRDSITEHFMPVKIGNISSPVTTVSLIDFSTDIAKEDILLATIDTGDAEISITSEVSGTLKDSSAGVADAPAFPRKKDEADMSNYNSSIKSNVP
Immunogen GTTNSITRDSITEHFMPVKIGNISSPVTTVSLIDFSTDIAKEDILLATIDTGDAEISITSEVSGTLKDSSAGVADAPAFPRKKDEADMSNYNSSIKSNVP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C4orf35, CLPH, FLJ32897, NYD-SP26
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96KC9
HTS Code 3002150000
Gene ID 85438
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CABS1 Antibody 100ul

Anti-CABS1 Antibody 100ul