GIPC1,C19orf3,GIPC
  • GIPC1,C19orf3,GIPC

Anti-GIPC1 Antibody 100ul

Ref: AN-HPA043958-100ul
Anti-GIPC1

Información del producto

Polyclonal Antibody against Human GIPC1, Gene description: GIPC PDZ domain containing family, member 1, Alternative Gene Names: C19orf3, GIPC, GLUT1CBP, Hs.6454, NIP, RGS19IP1, SEMCAP, SYNECTIN, TIP-2, Validated applications: IHC, WB, Uniprot ID: O14908, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GIPC1
Gene Description GIPC PDZ domain containing family, member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence EAINGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKAFDMISQRSAGGRPGSGPQLGTGR
Immunogen EAINGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKAFDMISQRSAGGRPGSGPQLGTGR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C19orf3, GIPC, GLUT1CBP, Hs.6454, NIP, RGS19IP1, SEMCAP, SYNECTIN, TIP-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14908
HTS Code 3002150000
Gene ID 10755
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GIPC1 Antibody 100ul

Anti-GIPC1 Antibody 100ul