VPS13B,CHS1,COH1
  • VPS13B,CHS1,COH1

Anti-VPS13B Antibody 100ul

Ref: AN-HPA043865-100ul
Anti-VPS13B

Información del producto

Polyclonal Antibody against Human VPS13B, Gene description: vacuolar protein sorting 13 homolog B (yeast), Alternative Gene Names: CHS1, COH1, Validated applications: ICC, WB, Uniprot ID: Q7Z7G8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name VPS13B
Gene Description vacuolar protein sorting 13 homolog B (yeast)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence PSVIKIHTLVESLKLSITDQQLPMFIRIMQLGIALYYGEIGNFKEGEIEDLTCHNKDMLGNITGSEDETR
Immunogen PSVIKIHTLVESLKLSITDQQLPMFIRIMQLGIALYYGEIGNFKEGEIEDLTCHNKDMLGNITGSEDETR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CHS1, COH1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z7G8
HTS Code 3002150000
Gene ID 157680
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-VPS13B Antibody 100ul

Anti-VPS13B Antibody 100ul