NT5M,dNT-2,dNT2,mdN
  • NT5M,dNT-2,dNT2,mdN

Anti-NT5M Antibody 25ul

Ref: AN-HPA043777-25ul
Anti-NT5M

Información del producto

Polyclonal Antibody against Human NT5M, Gene description: 5',3'-nucleotidase, mitochondrial, Alternative Gene Names: dNT-2, dNT2, mdN, Validated applications: IHC, WB, Uniprot ID: Q9NPB1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NT5M
Gene Description 5',3'-nucleotidase, mitochondrial
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence FELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKT
Immunogen FELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names dNT-2, dNT2, mdN
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NPB1
HTS Code 3002150000
Gene ID 56953
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NT5M Antibody 25ul

Anti-NT5M Antibody 25ul