MRPS11,FLJ22512
  • MRPS11,FLJ22512

Anti-MRPS11 Antibody 100ul

Ref: AN-HPA043752-100ul
Anti-MRPS11

Información del producto

Polyclonal Antibody against Human MRPS11, Gene description: mitochondrial ribosomal protein S11, Alternative Gene Names: FLJ22512, FLJ23406, HCC-2, Validated applications: IHC, WB, Uniprot ID: P82912, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MRPS11
Gene Description mitochondrial ribosomal protein S11
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence GFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNG
Immunogen GFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ22512, FLJ23406, HCC-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P82912
HTS Code 3002150000
Gene ID 64963
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MRPS11 Antibody 100ul

Anti-MRPS11 Antibody 100ul