CSH1,CSA,CSMT
  • CSH1,CSA,CSMT

Anti-CSH1 Antibody 100ul

Ref: AN-HPA043715-100ul
Anti-CSH1

Información del producto

Polyclonal Antibody against Human CSH1, Gene description: chorionic somatomammotropin hormone 1 (placental lactogen), Alternative Gene Names: CSA, CSMT, FLJ75407, hCS-A, PL, Validated applications: IHC, Uniprot ID: P0DML2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CSH1
Gene Description chorionic somatomammotropin hormone 1 (placental lactogen)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
Immunogen SHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CSA, CSMT, FLJ75407, hCS-A, PL
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P0DML2
HTS Code 3002150000
Gene ID 1442
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CSH1 Antibody 100ul

Anti-CSH1 Antibody 100ul