ACOT1,ACH2,CTE-1
  • ACOT1,ACH2,CTE-1

Anti-ACOT1 Antibody 100ul

Ref: AN-HPA043705-100ul
Anti-ACOT1

Información del producto

Polyclonal Antibody against Human ACOT1, Gene description: acyl-CoA thioesterase 1, Alternative Gene Names: ACH2, CTE-1, LACH2, Validated applications: ICC, IHC, WB, Uniprot ID: Q86TX2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ACOT1
Gene Description acyl-CoA thioesterase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence YKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWK
Immunogen YKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ACH2, CTE-1, LACH2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86TX2
HTS Code 3002150000
Gene ID 641371
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ACOT1 Antibody 100ul

Anti-ACOT1 Antibody 100ul