COL17A1,BP180,BPAG2
  • COL17A1,BP180,BPAG2

Anti-COL17A1 Antibody 100ul

Ref: AN-HPA043673-100ul
Anti-COL17A1

Información del producto

Polyclonal Antibody against Human COL17A1, Gene description: collagen, type XVII, alpha 1, Alternative Gene Names: BP180, BPAG2, Validated applications: IHC, WB, Uniprot ID: Q9UMD9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name COL17A1
Gene Description collagen, type XVII, alpha 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence DGTEVTERIVTETVTTRLTSLPPKGGTSNGYAKTASLGGGSRLEKQSLTHGSSGYINSTGSTRGHASTSSYRRAHSPASTLPNSPGSTFERKTHVTR
Immunogen DGTEVTERIVTETVTTRLTSLPPKGGTSNGYAKTASLGGGSRLEKQSLTHGSSGYINSTGSTRGHASTSSYRRAHSPASTLPNSPGSTFERKTHVTR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BP180, BPAG2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UMD9
HTS Code 3002150000
Gene ID 1308
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-COL17A1 Antibody 100ul

Anti-COL17A1 Antibody 100ul