MRPL17,MRP-L26
  • MRPL17,MRP-L26

Anti-MRPL17 Antibody 25ul

Ref: AN-HPA043666-25ul
Anti-MRPL17

Información del producto

Polyclonal Antibody against Human MRPL17, Gene description: mitochondrial ribosomal protein L17, Alternative Gene Names: MRP-L26, RPML26, Validated applications: IHC, Uniprot ID: Q9NRX2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MRPL17
Gene Description mitochondrial ribosomal protein L17
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PKLFQVLAPRYKDQTGGYTRMLQIPNRSLDRAKMAVIEYKGNCLPPLPLPRRDSHLTLLNQLLQGLRQDLRQSQEASNHSSHT
Immunogen PKLFQVLAPRYKDQTGGYTRMLQIPNRSLDRAKMAVIEYKGNCLPPLPLPRRDSHLTLLNQLLQGLRQDLRQSQEASNHSSHT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MRP-L26, RPML26
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NRX2
HTS Code 3002150000
Gene ID 63875
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MRPL17 Antibody 25ul

Anti-MRPL17 Antibody 25ul