PAF1,F23149_1
  • PAF1,F23149_1

Anti-PAF1 Antibody 100ul

Ref: AN-HPA043637-100ul
Anti-PAF1

Información del producto

Polyclonal Antibody against Human PAF1, Gene description: PAF1 homolog, Paf1/RNA polymerase II complex component, Alternative Gene Names: F23149_1, FLJ11123, PD2, Validated applications: ICC, Uniprot ID: Q8N7H5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PAF1
Gene Description PAF1 homolog, Paf1/RNA polymerase II complex component
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence ADEKLLEEEIQAPTSSKRSQQHAKVVPWMRKTEYISTEFNRYGISNEKPEVKIGVSVKQQFTEEEIYKDRDSQITAIEKTFEDAQKSISQHYSKPRVTP
Immunogen ADEKLLEEEIQAPTSSKRSQQHAKVVPWMRKTEYISTEFNRYGISNEKPEVKIGVSVKQQFTEEEIYKDRDSQITAIEKTFEDAQKSISQHYSKPRVTP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names F23149_1, FLJ11123, PD2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N7H5
HTS Code 3002150000
Gene ID 54623
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PAF1 Antibody 100ul

Anti-PAF1 Antibody 100ul