FAM160B1,bA106M7.3
  • FAM160B1,bA106M7.3

Anti-FAM160B1 Antibody 100ul

Ref: AN-HPA043624-100ul
Anti-FAM160B1

Información del producto

Polyclonal Antibody against Human FAM160B1, Gene description: family with sequence similarity 160, member B1, Alternative Gene Names: bA106M7.3, KIAA1600, Validated applications: ICC, IHC, WB, Uniprot ID: Q5W0V3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FAM160B1
Gene Description family with sequence similarity 160, member B1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence CGEVLATPTENEEIQFLCIVCAKLKQDPYLVNFFLENKMKSLASKGVPNVISEDTLKGQDSLSTDTGQSRQPEELSGATGMEQTELEDEPPHQMDHL
Immunogen CGEVLATPTENEEIQFLCIVCAKLKQDPYLVNFFLENKMKSLASKGVPNVISEDTLKGQDSLSTDTGQSRQPEELSGATGMEQTELEDEPPHQMDHL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA106M7.3, KIAA1600
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5W0V3
HTS Code 3002150000
Gene ID 57700
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FAM160B1 Antibody 100ul

Anti-FAM160B1 Antibody 100ul