NOL4L,C20orf112
  • NOL4L,C20orf112

Anti-NOL4L Antibody 25ul

Ref: AN-HPA043600-25ul
Anti-NOL4L

Información del producto

Polyclonal Antibody against Human NOL4L, Gene description: nucleolar protein 4-like, Alternative Gene Names: C20orf112, C20orf113, dJ1184F4.2, dJ1184F4.4, DKFZP566G1424, Validated applications: ICC, IHC, Uniprot ID: Q96MY1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NOL4L
Gene Description nucleolar protein 4-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence MRLEIYQSSQDEPIALDKQHSRDSAAITHSTYSLPASSYSQDPVYANGGLNYSYRGYGALSSNLQPPASLQTGNHSNGP
Immunogen MRLEIYQSSQDEPIALDKQHSRDSAAITHSTYSLPASSYSQDPVYANGGLNYSYRGYGALSSNLQPPASLQTGNHSNGP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf112, C20orf113, dJ1184F4.2, dJ1184F4.4, DKFZP566G1424
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96MY1
HTS Code 3002150000
Gene ID 140688
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NOL4L Antibody 25ul

Anti-NOL4L Antibody 25ul