PPP1R12C
  • PPP1R12C

Anti-PPP1R12C Antibody 25ul

Ref: AN-HPA043532-25ul
Anti-PPP1R12C

Información del producto

Polyclonal Antibody against Human PPP1R12C, Gene description: protein phosphatase 1, regulatory subunit 12C, Alternative Gene Names: DKFZP434D0412, LENG3, MBS85, p84, p85, Validated applications: IHC, Uniprot ID: Q9BZL4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PPP1R12C
Gene Description protein phosphatase 1, regulatory subunit 12C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DIARYLLSHGANIAAVNSDGDLPLDLAESDAMEGLLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHV
Immunogen DIARYLLSHGANIAAVNSDGDLPLDLAESDAMEGLLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP434D0412, LENG3, MBS85, p84, p85
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BZL4
HTS Code 3002150000
Gene ID 54776
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PPP1R12C Antibody 25ul

Anti-PPP1R12C Antibody 25ul