STUB1,CHIP,HSPABP2
  • STUB1,CHIP,HSPABP2

Anti-STUB1 Antibody 100ul

Ref: AN-HPA043531-100ul
Anti-STUB1

Información del producto

Polyclonal Antibody against Human STUB1, Gene description: STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase, Alternative Gene Names: CHIP, HSPABP2, NY-CO-7, SDCCAG7, UBOX1, Validated applications: ICC, IHC, Uniprot ID: Q9UNE7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name STUB1
Gene Description STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence LELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQ
Immunogen LELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CHIP, HSPABP2, NY-CO-7, SDCCAG7, UBOX1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UNE7
HTS Code 3002150000
Gene ID 10273
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-STUB1 Antibody 100ul

Anti-STUB1 Antibody 100ul