DUS2,DUS2L,FLJ20399
  • DUS2,DUS2L,FLJ20399

Anti-DUS2 Antibody 25ul

Ref: AN-HPA043528-25ul
Anti-DUS2

Información del producto

Polyclonal Antibody against Human DUS2, Gene description: dihydrouridine synthase 2, Alternative Gene Names: DUS2L, FLJ20399, SMM1, Validated applications: ICC, IHC, Uniprot ID: Q9NX74, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DUS2
Gene Description dihydrouridine synthase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence RLVENDVAGIDVNMGCPKQYSTKGGMGAALLSDPDKIEKILSTLVKGTRRPVTCKIRILPSLEDTLSLVKRIERTGIAAIAVHGRKREERPQHPVSCEVIKAIADTLSIP
Immunogen RLVENDVAGIDVNMGCPKQYSTKGGMGAALLSDPDKIEKILSTLVKGTRRPVTCKIRILPSLEDTLSLVKRIERTGIAAIAVHGRKREERPQHPVSCEVIKAIADTLSIP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DUS2L, FLJ20399, SMM1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NX74
HTS Code 3002150000
Gene ID 54920
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DUS2 Antibody 25ul

Anti-DUS2 Antibody 25ul