FERD3L,bHLHa31
  • FERD3L,bHLHa31

Anti-FERD3L Antibody 100ul

Ref: AN-HPA043494-100ul
Anti-FERD3L

Información del producto

Polyclonal Antibody against Human FERD3L, Gene description: Fer3-like bHLH transcription factor, Alternative Gene Names: bHLHa31, N-TWIST, NATO3, Validated applications: IHC, WB, Uniprot ID: Q96RJ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FERD3L
Gene Description Fer3-like bHLH transcription factor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence MAAYPESCVDTTVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEGDPEEEECEVDQ
Immunogen MAAYPESCVDTTVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEGDPEEEECEVDQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bHLHa31, N-TWIST, NATO3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96RJ6
HTS Code 3002150000
Gene ID 222894
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FERD3L Antibody 100ul

Anti-FERD3L Antibody 100ul