NSA2,FLJ94393,HCLG1
  • NSA2,FLJ94393,HCLG1

Anti-NSA2 Antibody 25ul

Ref: AN-HPA043487-25ul
Anti-NSA2

Información del producto

Polyclonal Antibody against Human NSA2, Gene description: NSA2 ribosome biogenesis homolog (S. cerevisiae), Alternative Gene Names: FLJ94393, HCLG1, HUSSY-29, TINP1, Validated applications: IHC, Uniprot ID: O95478, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NSA2
Gene Description NSA2 ribosome biogenesis homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VLSNMIKQKRKEKAGKWEVPLPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRF
Immunogen VLSNMIKQKRKEKAGKWEVPLPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ94393, HCLG1, HUSSY-29, TINP1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95478
HTS Code 3002150000
Gene ID 10412
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NSA2 Antibody 25ul

Anti-NSA2 Antibody 25ul