MICALL1,KIAA1668
  • MICALL1,KIAA1668

Anti-MICALL1 Antibody 100ul

Ref: AN-HPA043480-100ul
Anti-MICALL1

Información del producto

Polyclonal Antibody against Human MICALL1, Gene description: MICAL-like 1, Alternative Gene Names: KIAA1668, MICAL-L1, MIRAB13, Validated applications: ICC, IHC, WB, Uniprot ID: Q8N3F8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MICALL1
Gene Description MICAL-like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence PGAYENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVPGGGPSSSAPAGAEADGPKASPEARPQIPTKPRVPGKLQELA
Immunogen PGAYENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVPGGGPSSSAPAGAEADGPKASPEARPQIPTKPRVPGKLQELA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1668, MICAL-L1, MIRAB13
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N3F8
HTS Code 3002150000
Gene ID 85377
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MICALL1 Antibody 100ul

Anti-MICALL1 Antibody 100ul