TTC39A,C1orf34
  • TTC39A,C1orf34

Anti-TTC39A Antibody 100ul

Ref: AN-HPA043440-100ul
Anti-TTC39A

Información del producto

Polyclonal Antibody against Human TTC39A, Gene description: tetratricopeptide repeat domain 39A, Alternative Gene Names: C1orf34, DEME-6, KIAA0452, Validated applications: ICC, WB, Uniprot ID: Q5SRH9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TTC39A
Gene Description tetratricopeptide repeat domain 39A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence FLTNQFSEALSYLKPRTKESMYHSLTYATILEMQAMMTFDPQDILLAGNMMKEAQMLCQRHRRKSSVTDSFSSLVNRPTLGQFTEEEIHAEV
Immunogen FLTNQFSEALSYLKPRTKESMYHSLTYATILEMQAMMTFDPQDILLAGNMMKEAQMLCQRHRRKSSVTDSFSSLVNRPTLGQFTEEEIHAEV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf34, DEME-6, KIAA0452
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5SRH9
HTS Code 3002150000
Gene ID 22996
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TTC39A Antibody 100ul

Anti-TTC39A Antibody 100ul