CEACAM21,FLJ13540
  • CEACAM21,FLJ13540

Anti-CEACAM21 Antibody 100ul

Ref: AN-HPA043411-100ul
Anti-CEACAM21

Información del producto

Polyclonal Antibody against Human CEACAM21, Gene description: carcinoembryonic antigen-related cell adhesion molecule 21, Alternative Gene Names: FLJ13540, R29124_1, Validated applications: IHC, Uniprot ID: Q3KPI0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CEACAM21
Gene Description carcinoembryonic antigen-related cell adhesion molecule 21
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence IASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGP
Immunogen IASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ13540, R29124_1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q3KPI0
HTS Code 3002150000
Gene ID 90273
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CEACAM21 Antibody 100ul

Anti-CEACAM21 Antibody 100ul