TMEM255B,FAM70B
  • TMEM255B,FAM70B

Anti-TMEM255B Antibody 100ul

Ref: AN-HPA043334-100ul
Anti-TMEM255B

Información del producto

Polyclonal Antibody against Human TMEM255B, Gene description: transmembrane protein 255B, Alternative Gene Names: FAM70B, MGC20579, Validated applications: ICC, IHC, WB, Uniprot ID: Q8WV15, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TMEM255B
Gene Description transmembrane protein 255B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence VPLSQLAYGPAVPPQTLYNPAQQILAYAGFRLTPEPVPTCSSYPLPLQPCSRFPVAPSSALASSEDLQPPSPSSSGSGLPGQAPPCYAP
Immunogen VPLSQLAYGPAVPPQTLYNPAQQILAYAGFRLTPEPVPTCSSYPLPLQPCSRFPVAPSSALASSEDLQPPSPSSSGSGLPGQAPPCYAP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FAM70B, MGC20579
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WV15
HTS Code 3002150000
Gene ID 348013
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TMEM255B Antibody 100ul

Anti-TMEM255B Antibody 100ul