UFSP2,C4orf20
  • UFSP2,C4orf20

Anti-UFSP2 Antibody 25ul

Ref: AN-HPA043298-25ul
Anti-UFSP2

Información del producto

Polyclonal Antibody against Human UFSP2, Gene description: UFM1-specific peptidase 2, Alternative Gene Names: C4orf20, FLJ11200, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NUQ7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name UFSP2
Gene Description UFM1-specific peptidase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence LAFQLATPNEIFLKKALKHVLSDLSTKLSSNALVFRICHSSVYIWPSSDINTIPGELTDASACKNILRFIQFEPEED
Immunogen LAFQLATPNEIFLKKALKHVLSDLSTKLSSNALVFRICHSSVYIWPSSDINTIPGELTDASACKNILRFIQFEPEED
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C4orf20, FLJ11200
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NUQ7
HTS Code 3002150000
Gene ID 55325
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-UFSP2 Antibody 25ul

Anti-UFSP2 Antibody 25ul