RBM12,HRIHFB2091
  • RBM12,HRIHFB2091

Anti-RBM12 Antibody 25ul

Ref: AN-HPA043258-25ul
Anti-RBM12

Información del producto

Polyclonal Antibody against Human RBM12, Gene description: RNA binding motif protein 12, Alternative Gene Names: HRIHFB2091, KIAA0765, SWAN, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NTZ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RBM12
Gene Description RNA binding motif protein 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence GSGAPMNLNNNLNPMFLGPLNPVNPIQMNSQSSVKPLPINPDDLYVSVHGMPFSAMENDVRDFFHGLRVDAVHLLKDHVGRNNGNGLV
Immunogen GSGAPMNLNNNLNPMFLGPLNPVNPIQMNSQSSVKPLPINPDDLYVSVHGMPFSAMENDVRDFFHGLRVDAVHLLKDHVGRNNGNGLV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HRIHFB2091, KIAA0765, SWAN
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NTZ6
HTS Code 3002150000
Gene ID 10137
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RBM12 Antibody 25ul

Anti-RBM12 Antibody 25ul