ARHGAP19,FLJ00194
  • ARHGAP19,FLJ00194

Anti-ARHGAP19 Antibody 100ul

Ref: AN-HPA043231-100ul
Anti-ARHGAP19

Información del producto

Polyclonal Antibody against Human ARHGAP19, Gene description: Rho GTPase activating protein 19, Alternative Gene Names: FLJ00194, MGC14258, Validated applications: ICC, IHC, WB, Uniprot ID: Q14CB8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ARHGAP19
Gene Description Rho GTPase activating protein 19
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence LLTHKHFNAHLKIADLMQFDDKGNKTNIPDKDRQIEALQLLFLILPPPNRNLLKLLLDLLYQTAKKQDKNKMSAYNLALMF
Immunogen LLTHKHFNAHLKIADLMQFDDKGNKTNIPDKDRQIEALQLLFLILPPPNRNLLKLLLDLLYQTAKKQDKNKMSAYNLALMF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ00194, MGC14258
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14CB8
HTS Code 3002150000
Gene ID 84986
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ARHGAP19 Antibody 100ul

Anti-ARHGAP19 Antibody 100ul