TUBGCP4,76P,FLJ14797
  • TUBGCP4,76P,FLJ14797

Anti-TUBGCP4 Antibody 25ul

Ref: AN-HPA043212-25ul
Anti-TUBGCP4

Información del producto

Polyclonal Antibody against Human TUBGCP4, Gene description: tubulin, gamma complex associated protein 4, Alternative Gene Names: 76P, FLJ14797, Validated applications: ICC, IHC, WB, Uniprot ID: Q9UGJ1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TUBGCP4
Gene Description tubulin, gamma complex associated protein 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence ILFVGESVQMFENQNVNLTRKGSILKNQEDTFAAELHRLKQQPLFSLVDFEQVVDRIRSTVAEHLWKLMVEESDLLGQLKIIKDFYLLGRGELFQAFIDTAQHMLKTPPTA
Immunogen ILFVGESVQMFENQNVNLTRKGSILKNQEDTFAAELHRLKQQPLFSLVDFEQVVDRIRSTVAEHLWKLMVEESDLLGQLKIIKDFYLLGRGELFQAFIDTAQHMLKTPPTA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 76P, FLJ14797
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UGJ1
HTS Code 3002150000
Gene ID 27229
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TUBGCP4 Antibody 25ul

Anti-TUBGCP4 Antibody 25ul