FAM193A,C4orf8
  • FAM193A,C4orf8

Anti-FAM193A Antibody 25ul

Ref: AN-HPA043116-25ul
Anti-FAM193A

Información del producto

Polyclonal Antibody against Human FAM193A, Gene description: family with sequence similarity 193, member A, Alternative Gene Names: C4orf8, RES4-22, Validated applications: ICC, IHC, Uniprot ID: P78312, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FAM193A
Gene Description family with sequence similarity 193, member A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence RSISTFLGTLENEHLKKFQVTWELHNKHLFENLVFSEPLLQSNLPALVSQIRLGTTTHDTCSEDTYSTLLQRYQRSEEELRRVAEEWLECQKRIDAYVDEQM
Immunogen RSISTFLGTLENEHLKKFQVTWELHNKHLFENLVFSEPLLQSNLPALVSQIRLGTTTHDTCSEDTYSTLLQRYQRSEEELRRVAEEWLECQKRIDAYVDEQM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C4orf8, RES4-22
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P78312
HTS Code 3002150000
Gene ID 8603
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FAM193A Antibody 25ul

Anti-FAM193A Antibody 25ul