DEFB125,DEFB-25
  • DEFB125,DEFB-25

Anti-DEFB125 Antibody 100ul

Ref: AN-HPA043095-100ul
Anti-DEFB125

Información del producto

Polyclonal Antibody against Human DEFB125, Gene description: defensin, beta 125, Alternative Gene Names: DEFB-25, Validated applications: IHC, WB, Uniprot ID: Q8N687, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DEFB125
Gene Description defensin, beta 125
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence PVSMLNDLITFDTTKFGETMTPETNTPETTMPPSEATTPETTMPPSETATSETMPPPSQTALTHN
Immunogen PVSMLNDLITFDTTKFGETMTPETNTPETTMPPSEATTPETTMPPSETATSETMPPPSQTALTHN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DEFB-25
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N687
HTS Code 3002150000
Gene ID 245938
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DEFB125 Antibody 100ul

Anti-DEFB125 Antibody 100ul