PLA2G4C,cPLA2-gamma
  • PLA2G4C,cPLA2-gamma

Anti-PLA2G4C Antibody 100ul

Ref: AN-HPA043083-100ul
Anti-PLA2G4C

Información del producto

Polyclonal Antibody against Human PLA2G4C, Gene description: phospholipase A2, group IVC (cytosolic, calcium-independent), Alternative Gene Names: cPLA2-gamma, Validated applications: IHC, Uniprot ID: Q9UP65, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PLA2G4C
Gene Description phospholipase A2, group IVC (cytosolic, calcium-independent)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIEAWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKD
Immunogen EAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIEAWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names cPLA2-gamma
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UP65
HTS Code 3002150000
Gene ID 8605
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PLA2G4C Antibody 100ul

Anti-PLA2G4C Antibody 100ul