UQCRB,QCR7,QP-C
  • UQCRB,QCR7,QP-C

Anti-UQCRB Antibody 100ul

Ref: AN-HPA043060-100ul
Anti-UQCRB

Información del producto

Polyclonal Antibody against Human UQCRB, Gene description: ubiquinol-cytochrome c reductase binding protein, Alternative Gene Names: QCR7, QP-C, UQBP, UQCR6, Validated applications: IHC, WB, Uniprot ID: P14927, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name UQCRB
Gene Description ubiquinol-cytochrome c reductase binding protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence LPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK
Immunogen LPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names QCR7, QP-C, UQBP, UQCR6
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P14927
HTS Code 3002150000
Gene ID 7381
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-UQCRB Antibody 100ul

Anti-UQCRB Antibody 100ul