TIMM44,TIM44
  • TIMM44,TIM44

Anti-TIMM44 Antibody 25ul

Ref: AN-HPA043052-25ul
Anti-TIMM44

Información del producto

Polyclonal Antibody against Human TIMM44, Gene description: translocase of inner mitochondrial membrane 44 homolog (yeast), Alternative Gene Names: TIM44, Validated applications: ICC, IHC, WB, Uniprot ID: O43615, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TIMM44
Gene Description translocase of inner mitochondrial membrane 44 homolog (yeast)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence EVLRKKLGELTGTVKESLHEVSKSDLGRKIKEGVEEAAKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKF
Immunogen EVLRKKLGELTGTVKESLHEVSKSDLGRKIKEGVEEAAKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TIM44
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43615
HTS Code 3002150000
Gene ID 10469
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TIMM44 Antibody 25ul

Anti-TIMM44 Antibody 25ul