RNF166,MGC14381
  • RNF166,MGC14381

Anti-RNF166 Antibody 100ul

Ref: AN-HPA042970-100ul
Anti-RNF166

Información del producto

Polyclonal Antibody against Human RNF166, Gene description: ring finger protein 166, Alternative Gene Names: MGC14381, MGC2647, Validated applications: ICC, WB, Uniprot ID: Q96A37, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RNF166
Gene Description ring finger protein 166
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence PCRGCNKKVTLAKMRVHISSCLKVQEQMANCPKFVPVVPTSQPIPSNIPNRSTFACPYCGARNLDQQELVKHCVESHRSDPNRVVCPICSAMP
Immunogen PCRGCNKKVTLAKMRVHISSCLKVQEQMANCPKFVPVVPTSQPIPSNIPNRSTFACPYCGARNLDQQELVKHCVESHRSDPNRVVCPICSAMP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC14381, MGC2647
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96A37
HTS Code 3002150000
Gene ID 115992
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RNF166 Antibody 100ul

Anti-RNF166 Antibody 100ul