OR10J3,OR10J3P
  • OR10J3,OR10J3P

Anti-OR10J3 Antibody 100ul

Ref: AN-HPA042963-100ul
Anti-OR10J3

Información del producto

Polyclonal Antibody against Human OR10J3, Gene description: olfactory receptor, family 10, subfamily J, member 3, Alternative Gene Names: OR10J3P, Validated applications: IHC, Uniprot ID: Q5JRS4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name OR10J3
Gene Description olfactory receptor, family 10, subfamily J, member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LKPKSQSSLGQDRLISVTYTHHSPTEPCCVQPEEQGGQRCSAQSRGAKNSVSLMKRGCEGFSFAFINMY
Immunogen LKPKSQSSLGQDRLISVTYTHHSPTEPCCVQPEEQGGQRCSAQSRGAKNSVSLMKRGCEGFSFAFINMY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names OR10J3P
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5JRS4
HTS Code 3002150000
Gene ID 441911
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-OR10J3 Antibody 100ul

Anti-OR10J3 Antibody 100ul