OR2AE1,OR2AE2
  • OR2AE1,OR2AE2

Anti-OR2AE1 Antibody 100ul

Ref: AN-HPA042957-100ul
Anti-OR2AE1

Información del producto

Polyclonal Antibody against Human OR2AE1, Gene description: olfactory receptor, family 2, subfamily AE, member 1, Alternative Gene Names: OR2AE2, Validated applications: IHC, Uniprot ID: Q8NHA4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name OR2AE1
Gene Description olfactory receptor, family 2, subfamily AE, member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MHFPFCGPRKVYHFYCEFPAVVKLVCGDITVYETTV
Immunogen MHFPFCGPRKVYHFYCEFPAVVKLVCGDITVYETTV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names OR2AE2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NHA4
HTS Code 3002150000
Gene ID 81392
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-OR2AE1 Antibody 100ul

Anti-OR2AE1 Antibody 100ul