FAM126A,DRCTNNB1A
  • FAM126A,DRCTNNB1A

Anti-FAM126A Antibody 25ul

Ref: AN-HPA042873-25ul
Anti-FAM126A

Información del producto

Polyclonal Antibody against Human FAM126A, Gene description: family with sequence similarity 126, member A, Alternative Gene Names: DRCTNNB1A , HCC, HYCC1, hyccin, Validated applications: ICC, IHC, WB, Uniprot ID: Q9BYI3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FAM126A
Gene Description family with sequence similarity 126, member A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence PSSHGLAKTAATVFSKSFEQVSGVTVPHNPSSAVGCGAGTDANRFSACSLQEEKLIYVSERTELPMKHQSGQQ
Immunogen PSSHGLAKTAATVFSKSFEQVSGVTVPHNPSSAVGCGAGTDANRFSACSLQEEKLIYVSERTELPMKHQSGQQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DRCTNNB1A , HCC, HYCC1, hyccin
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BYI3
HTS Code 3002150000
Gene ID 84668
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FAM126A Antibody 25ul

Anti-FAM126A Antibody 25ul