CNEP1R1,C16orf69
  • CNEP1R1,C16orf69

Anti-CNEP1R1 Antibody 100ul

Ref: AN-HPA042815-100ul
Anti-CNEP1R1

Información del producto

Polyclonal Antibody against Human CNEP1R1, Gene description: CTD nuclear envelope phosphatase 1 regulatory subunit 1, Alternative Gene Names: C16orf69, FLJ38101, NEP1-R1, TMEM188, Validated applications: IHC, Uniprot ID: Q8N9A8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CNEP1R1
Gene Description CTD nuclear envelope phosphatase 1 regulatory subunit 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRSVLLHII
Immunogen MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRSVLLHII
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C16orf69, FLJ38101, NEP1-R1, TMEM188
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N9A8
HTS Code 3002150000
Gene ID 255919
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CNEP1R1 Antibody 100ul

Anti-CNEP1R1 Antibody 100ul