NDUFB9,B22,LYRM3
  • NDUFB9,B22,LYRM3

Anti-NDUFB9 Antibody 100ul

Ref: AN-HPA042768-100ul
Anti-NDUFB9

Información del producto

Polyclonal Antibody against Human NDUFB9, Gene description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa, Alternative Gene Names: B22, LYRM3, UQOR22, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y6M9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NDUFB9
Gene Description NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence FWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQ
Immunogen FWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B22, LYRM3, UQOR22
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y6M9
HTS Code 3002150000
Gene ID 4715
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NDUFB9 Antibody 100ul

Anti-NDUFB9 Antibody 100ul