POP4,RPP29
  • POP4,RPP29

Anti-POP4 Antibody 25ul

Ref: AN-HPA042748-25ul
Anti-POP4

Información del producto

Polyclonal Antibody against Human POP4, Gene description: processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae), Alternative Gene Names: RPP29, Validated applications: IHC, WB, Uniprot ID: O95707, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name POP4
Gene Description processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence KKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAI
Immunogen KKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names RPP29
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95707
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-POP4 Antibody 25ul

Anti-POP4 Antibody 25ul