OSBPL2,KIAA0772
  • OSBPL2,KIAA0772

Anti-OSBPL2 Antibody 100ul

Ref: AN-HPA042659-100ul
Anti-OSBPL2

Información del producto

Polyclonal Antibody against Human OSBPL2, Gene description: oxysterol binding protein-like 2, Alternative Gene Names: KIAA0772, ORP-2, Validated applications: IHC, WB, Uniprot ID: Q9H1P3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name OSBPL2
Gene Description oxysterol binding protein-like 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence VEGHIQDKNKKKLFMIYGKWTECLWGIDPVSYESFKKQERRGDHLRKAKLDEDSGKADSDVADDVPVAQETVQVIPGSKL
Immunogen VEGHIQDKNKKKLFMIYGKWTECLWGIDPVSYESFKKQERRGDHLRKAKLDEDSGKADSDVADDVPVAQETVQVIPGSKL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0772, ORP-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H1P3
HTS Code 3002150000
Gene ID 9885
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-OSBPL2 Antibody 100ul

Anti-OSBPL2 Antibody 100ul