ACP7,FLJ16165,PAPL
  • ACP7,FLJ16165,PAPL

Anti-ACP7 Antibody 100ul

Ref: AN-HPA042613-100ul
Anti-ACP7

Información del producto

Polyclonal Antibody against Human ACP7, Gene description: acid phosphatase 7, tartrate resistant (putative), Alternative Gene Names: FLJ16165, PAPL, PAPL1, Validated applications: IHC, Uniprot ID: Q6ZNF0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ACP7
Gene Description acid phosphatase 7, tartrate resistant (putative)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QVHLSYPGEPGSMTVTWTTWVPTRSEVQFGLQPSGPLPLRAQGTFVPFVDGGILRRKLYIHRVTLRKLLPGVQYVYRCG
Immunogen QVHLSYPGEPGSMTVTWTTWVPTRSEVQFGLQPSGPLPLRAQGTFVPFVDGGILRRKLYIHRVTLRKLLPGVQYVYRCG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ16165, PAPL, PAPL1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZNF0
HTS Code 3002150000
Gene ID 390928
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ACP7 Antibody 100ul

Anti-ACP7 Antibody 100ul