CENPV,CENP-V,p30
  • CENPV,CENP-V,p30

Anti-CENPV Antibody 100ul

Ref: AN-HPA042529-100ul
Anti-CENPV

Información del producto

Polyclonal Antibody against Human CENPV, Gene description: centromere protein V, Alternative Gene Names: CENP-V, p30, PRR6, Validated applications: IHC, WB, Uniprot ID: Q7Z7K6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CENPV
Gene Description centromere protein V
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence HFIVPASRFKLLKGAEHITTYTFNTHKAQHTFCKRCGVQSFYTPRSNPGGFGIAPHCLDEGTVRSMV
Immunogen HFIVPASRFKLLKGAEHITTYTFNTHKAQHTFCKRCGVQSFYTPRSNPGGFGIAPHCLDEGTVRSMV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CENP-V, p30, PRR6
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z7K6
HTS Code 3002150000
Gene ID 201161
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CENPV Antibody 100ul

Anti-CENPV Antibody 100ul