CIB1,CIB,KIP,SIP2-28
  • CIB1,CIB,KIP,SIP2-28

Anti-CIB1 Antibody 25ul

Ref: AN-HPA042413-25ul
Anti-CIB1

Información del producto

Polyclonal Antibody against Human CIB1, Gene description: calcium and integrin binding 1, Alternative Gene Names: CIB, KIP, SIP2-28, Validated applications: IHC, Uniprot ID: Q99828, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CIB1
Gene Description calcium and integrin binding 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLD
Immunogen SGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CIB, KIP, SIP2-28
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99828
HTS Code 3002150000
Gene ID 10519
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CIB1 Antibody 25ul

Anti-CIB1 Antibody 25ul