TMEM198,MGC99813
  • TMEM198,MGC99813

Anti-TMEM198 Antibody 100ul

Ref: AN-HPA042385-100ul
Anti-TMEM198

Información del producto

Polyclonal Antibody against Human TMEM198, Gene description: transmembrane protein 198, Alternative Gene Names: MGC99813, TMEM198A, Validated applications: ICC, Uniprot ID: Q66K66, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TMEM198
Gene Description transmembrane protein 198
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GTVATLRFQLLPPEPDDAFWGAPCEQPLERRYQ
Immunogen GTVATLRFQLLPPEPDDAFWGAPCEQPLERRYQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC99813, TMEM198A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q66K66
HTS Code 3002150000
Gene ID 130612
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TMEM198 Antibody 100ul

Anti-TMEM198 Antibody 100ul