STOML1,FLJ36370
  • STOML1,FLJ36370

Anti-STOML1 Antibody 100ul

Ref: AN-HPA042353-100ul
Anti-STOML1

Información del producto

Polyclonal Antibody against Human STOML1, Gene description: stomatin (EPB72)-like 1, Alternative Gene Names: FLJ36370, hUNC-24, SLP-1, STORP, Validated applications: ICC, IHC, WB, Uniprot ID: Q9UBI4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name STOML1
Gene Description stomatin (EPB72)-like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence GPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGADVQFRIWDPVLSVMTVKDLNTATRMTAQNAMTKALLKRPLREIQMEKLKISDQLLLEINDVTRA
Immunogen GPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGADVQFRIWDPVLSVMTVKDLNTATRMTAQNAMTKALLKRPLREIQMEKLKISDQLLLEINDVTRA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ36370, hUNC-24, SLP-1, STORP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UBI4
HTS Code 3002150000
Gene ID 9399
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-STOML1 Antibody 100ul

Anti-STOML1 Antibody 100ul