B4GALT7,beta4Gal-T7
  • B4GALT7,beta4Gal-T7

Anti-B4GALT7 Antibody 25ul

Ref: AN-HPA042330-25ul
Anti-B4GALT7

Información del producto

Polyclonal Antibody against Human B4GALT7, Gene description: xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7, Alternative Gene Names: beta4Gal-T7, XGALT-1, Validated applications: IHC, WB, Uniprot ID: Q9UBV7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name B4GALT7
Gene Description xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence PEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLSRKKIRHHIYVLNQVDHFRFNRAALINVGFLESSNSTDYIAMHDVDLLPLNEELDYGFPEAGPFHVASPELHPLYHYKTYVG
Immunogen PEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLSRKKIRHHIYVLNQVDHFRFNRAALINVGFLESSNSTDYIAMHDVDLLPLNEELDYGFPEAGPFHVASPELHPLYHYKTYVG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names beta4Gal-T7, XGALT-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UBV7
HTS Code 3002150000
Gene ID 11285
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-B4GALT7 Antibody 25ul

Anti-B4GALT7 Antibody 25ul