IL20RA,IL-20R1
  • IL20RA,IL-20R1

Anti-IL20RA Antibody 25ul

Ref: AN-HPA042281-25ul
Anti-IL20RA

Información del producto

Polyclonal Antibody against Human IL20RA, Gene description: interleukin 20 receptor, alpha, Alternative Gene Names: IL-20R1, ZCYTOR7, Validated applications: IHC, Uniprot ID: Q9UHF4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IL20RA
Gene Description interleukin 20 receptor, alpha
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLK
Immunogen DYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IL-20R1, ZCYTOR7
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UHF4
HTS Code 3002150000
Gene ID 53832
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IL20RA Antibody 25ul

Anti-IL20RA Antibody 25ul