GPSM1,AGS3
  • GPSM1,AGS3

Anti-GPSM1 Antibody 25ul

Ref: AN-HPA042199-25ul
Anti-GPSM1

Información del producto

Polyclonal Antibody against Human GPSM1, Gene description: G-protein signaling modulator 1, Alternative Gene Names: AGS3, DKFZP727I051, Validated applications: ICC, IHC, Uniprot ID: , Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GPSM1
Gene Description G-protein signaling modulator 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence SPAASEKPDLAGYEAQGARPKRTQRLSAETWDLLRLPLEREQNGDSHHSGDWRGPSRDSLPLPVRSRK
Immunogen SPAASEKPDLAGYEAQGARPKRTQRLSAETWDLLRLPLEREQNGDSHHSGDWRGPSRDSLPLPVRSRK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AGS3, DKFZP727I051
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
HTS Code 3002150000
Gene ID 26086
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GPSM1 Antibody 25ul

Anti-GPSM1 Antibody 25ul