TCP11L2,MGC40368
  • TCP11L2,MGC40368

Anti-TCP11L2 Antibody 25ul

Ref: AN-HPA042188-25ul
Anti-TCP11L2

Información del producto

Polyclonal Antibody against Human TCP11L2, Gene description: t-complex 11, testis-specific-like 2, Alternative Gene Names: MGC40368, Validated applications: ICC, IHC, WB, Uniprot ID: Q8N4U5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TCP11L2
Gene Description t-complex 11, testis-specific-like 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence SLIDKRIKLYMRRLLCLPSPQKCMPPMPGGLAVIQQELEALGSQYANIVNLNKQVYGPFYANILRKLLFNEEAMGKVDASPPTN
Immunogen SLIDKRIKLYMRRLLCLPSPQKCMPPMPGGLAVIQQELEALGSQYANIVNLNKQVYGPFYANILRKLLFNEEAMGKVDASPPTN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC40368
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N4U5
HTS Code 3002150000
Gene ID 255394
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TCP11L2 Antibody 25ul

Anti-TCP11L2 Antibody 25ul